Loading...
Statistics

doserve.com
www.doserve.com/
Advertisement

Doserve.com

Home Conversion Technology Metas Server
Doserve.com is hosted in China / Beijing . Doserve.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_323_1608221.js, Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: Tengine/1.4.2.

Technologies in use by Doserve.com

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_323_1608221.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Doserve.com

Missing HTTPS protocol.

    Meta - Doserve.com

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 124.16.31.156
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • parkmydomain.vhostgo.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Wed, 31 Aug 2016 02:45:48 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=knnluopmjuimghjv8vr9eiv145; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_ch6 X-Cache-Lookup: MISS from s_ch6:80 Transfer-Encoding: chunked Via: 1.1 s_ch6 (squid/3.5.20) Connection: keep-alive

    DNS

    host: parkmydomain.vhostgo.com
    1. class: IN
    2. ttl: 1627
    3. type: A
    4. ip: 124.16.31.156
    host: doserve.com
    1. class: IN
    2. ttl: 900
    3. type: CNAME
    4. target: parkmydomain.vhostgo.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.oserve.com, www.dtoserve.com, www.toserve.com, www.dgoserve.com, www.goserve.com, www.dboserve.com, www.boserve.com, www.dxoserve.com, www.xoserve.com, www.dsoserve.com, www.soserve.com, www.dfoserve.com, www.foserve.com, www.dvoserve.com, www.voserve.com, www.dyoserve.com, www.yoserve.com, www.dzoserve.com, www.zoserve.com, www.daoserve.com, www.aoserve.com, www.deoserve.com, www.eoserve.com, www.droserve.com, www.roserve.com, www.dserve.com, www.dobserve.com, www.dbserve.com, www.dohserve.com, www.dhserve.com, www.dogserve.com, www.dgserve.com, www.dojserve.com, www.djserve.com, www.domserve.com, www.dmserve.com, www.do serve.com, www.d serve.com, www.dovserve.com, www.dvserve.com, www.doerve.com, www.doseerve.com, www.doeerve.com, www.doswerve.com, www.dowerve.com, www.dosderve.com, www.doderve.com, www.dosxerve.com, www.doxerve.com, www.dosferve.com, www.doferve.com, www.dosgerve.com, www.dogerve.com, www.dosterve.com, www.doterve.com, www.dosrve.com, www.dosxrve.com, www.dosesrve.com, www.dossrve.com, www.dosewrve.com, www.doswrve.com, www.doserrve.com, www.dosrrve.com, www.dosefrve.com, www.dosfrve.com, www.dosevrve.com, www.dosvrve.com, www.dosecrve.com, www.doscrve.com, www.doseqrve.com, www.dosqrve.com, www.dosearve.com, www.dosarve.com, www.doseyrve.com, www.dosyrve.com, www.doseve.com, www.doserive.com, www.doseive.com, www.doserove.com, www.doseove.com, www.doserlve.com, www.doselve.com, www.doserlve.com, www.doselve.com, www.doser.ve.com, www.dose.ve.com, www.dosere.com, www.doservye.com, www.doserye.com, www.doservze.com, www.doserze.com, www.doservhe.com, www.doserhe.com, www.doservne.com, www.doserne.com, www.doservme.com, www.doserme.com, www.doservje.com, www.doserje.com, www.doservke.com, www.doserke.com, www.doservie.com, www.doserie.com, www.doserv.com, www.doservex.com, www.doservx.com, www.doserves.com, www.doservs.com, www.doservew.com, www.doservw.com, www.doserver.com, www.doservr.com, www.doservef.com, www.doservf.com, www.doservev.com, www.doservv.com, www.doservec.com, www.doservc.com, www.doserveq.com, www.doservq.com, www.doservea.com, www.doserva.com, www.doservey.com, www.doservy.com,

    Other Reviews

    1. Nittardi Photos
      Scottsdale (United States) - 184.168.193.46
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Cufon, Html, Html5, Javascript, jQuery, Chartbeat, Google Analytics
      Number of Javascript: 12
      Number of meta tags: 1
    2. bryan ballew photography
      After serving as a police officer for 5 years and 11 years in the corporate world, I discovered a passion for photography. 30328, United States
      Austria - 2.21.246.19
      Server software:
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    3. Summer Time! - Festive Summer- Beach time, Out of Doors, Road Trips, Weddings, Family celebrations, Fun Festive Occasions
      SJ'S GIFTS GALORE!
      Los Angeles (United States) - 208.122.238.180
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Google Font API, Html, Javascript, jQuery Cycle
      Number of Javascript: 9
      Number of meta tags: 8
    4. Ventura Creative Projects - Art Work By Artist Anna Ventura
      Art work and design projects by artist Anna Ventura based in Kingsbridge, Devon. Pastel portraits, acrylic and ink paintings and prints, hand-painted jewellery.
      Houston (United States) - 192.185.52.145
      G Analytics ID: UA-35962620-8
      Server software: nginx/1.10.1
      Technology: CSS, Google Font API, Gravatar, Html, Javascript, jQuery, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 19
      Number of meta tags: 9
    5. Welcome! Something should be here soon! - Decultured.
      United States - 74.87.163.243
      Server software: nginx/1.1.19
      Technology: CSS
      Number of meta tags: 4
    6. memot.de
      Italy - 212.183.164.30
      Server software: Apache/2.2.14 (Ubuntu)
      Technology: CSS, Html
      Number of meta tags: 1
    7. nancykhawamfamilylawandmediation.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    8. bam-tix.com
      Ashburn (United States) - 54.88.8.22
      Server software: Microsoft-IIS/7.5
      Technology: BootstrapCDN, Google Adsense, AJAX Libraries API, CSS, Font Awesome, Html, Html5, Javascript, jQuery UI
      Number of Javascript: 11
      Number of meta tags: 3
    9. FILIRICCI - Tecnologie Soluzioni Produzione
      Italy - 195.60.128.19
      Server software:
      Technology: Html, Php
      Number of Javascript: 1
      Number of meta tags: 1
    10. VBZV | Pluralistische beroepsvereniging van zelfstandige thuisverpleegkundigen
      Belgium - 188.93.153.89
      Server software: Apache
      Technology: CSS, Html, Html5, jQuery Colorbox, Php, Google Analytics, Drupal
      Number of Javascript: 9
      Number of meta tags: 3